C1orf144 antibody (N-Term)
-
- Target See all C1orf144 Antibodies
- C1orf144 (Chromosome 1 Open Reading Frame 144 (C1orf144))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C1orf144 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 orf144 antibody was raised against the N terminal of C1 rf144
- Purification
- Affinity purified
- Immunogen
- C1 orf144 antibody was raised using the N terminal of C1 rf144 corresponding to a region with amino acids MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN
- Top Product
- Discover our top product C1orf144 Primary Antibody
-
anti-Chromosome 1 Open Reading Frame 144 (C1orf144) (N-Term) antibody
C1orf144 Reactivity: Human, Mouse, Rat, Dog, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-Chromosome 1 Open Reading Frame 144 (C1orf144) (N-Term) antibodyC1orf144 Reactivity: Human, Mouse, Rat, Cow, Rabbit WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Chromosome 1 Open Reading Frame 144 (C1orf144) (AA 6-36), (N-Term) antibodyC1orf144 Reactivity: Human, Mouse WB, EIA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1orf144 Blocking Peptide, catalog no. 33R-6383, is also available for use as a blocking control in assays to test for specificity of this C1orf144 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf144 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1orf144 (Chromosome 1 Open Reading Frame 144 (C1orf144))
- Alternative Name
- C1orf144 (C1orf144 Products)
- Synonyms
- MGC82291 antibody, MGC76116 antibody, DKFZp468H135 antibody, C1orf144 antibody, SZRD1 antibody, 1110022I03 antibody, D4Ertd22e antibody, C2H1orf144 antibody, wu:fb15h05 antibody, wu:fk86c07 antibody, zgc:109926 antibody, RGD1560286 antibody, SUZ RNA binding domain containing 1 L homeolog antibody, SUZ RNA binding domain containing 1 antibody, szrd1.L antibody, szrd1 antibody, SZRD1 antibody, Szrd1 antibody
- Background
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 15 kDa (MW of target protein)
-
