KLHDC9 antibody (Middle Region)

Catalog No. ABIN632579

Product Details anti-KLHDC9 Antibody

Target: KLHDC9 (Kelch Domain Containing 9 (KLHDC9))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHDC9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLHDC9 antibody was raised against the middle region of KLHDC9

Purification: Affinity purified

Immunogen: KLHDC9 antibody was raised using the middle region of KLHDC9 corresponding to a region with amino acids AEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHDC9 Blocking Peptide, catalog no. 33R-1143, is also available for use as a blocking control in assays to test for specificity of this KLHDC9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHDC9

Target: KLHDC9 (Kelch Domain Containing 9 (KLHDC9))

Alternative Name: KLHDC9 (KLHDC9 Products)

Synonyms: KARCA1 antibody, 1190002J23Rik antibody, AA087357 antibody, ESTM31 antibody, kelch domain containing 9 antibody, KLHDC9 antibody, Klhdc9 antibody

Background: The function of KLHDC9 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 38 kDa (MW of target protein)