C18ORF25 antibody (N-Term)

Catalog No. ABIN632578

Product Details anti-C18ORF25 Antibody

Target: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C18ORF25 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C18 orf25 antibody was raised against the N terminal of C18 rf25

Purification: Affinity purified

Immunogen: C18 orf25 antibody was raised using the N terminal of C18 rf25 corresponding to a region with amino acids MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C18orf25 Blocking Peptide, catalog no. 33R-6153, is also available for use as a blocking control in assays to test for specificity of this C18orf25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C18ORF25

Target: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Alternative Name: C18orf25 (C18ORF25 Products)

Synonyms: ARKL1 antibody, Akd2 antibody, chromosome 18 open reading frame 25 antibody, chromosome 18 open reading frame 25 L homeolog antibody, chromosome W open reading frame, human C18orf25 antibody, chromosome 18 open reading frame, human C18orf25 antibody, RIKEN cDNA 8030462N17 gene antibody, C18orf25 antibody, c18orf25.L antibody, c18orf25 antibody, CWH18ORF25 antibody, C18H18orf25 antibody, 8030462N17Rik antibody

Background: The function of C18orf25 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 37 kDa (MW of target protein)