GLUD2 antibody (N-Term)
-
- Target See all GLUD2 Antibodies
- GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLUD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GLUD2 antibody was raised against the N terminal of GLUD2
- Purification
- Affinity purified
- Immunogen
- GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF
- Top Product
- Discover our top product GLUD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLUD2 Blocking Peptide, catalog no. 33R-2428, is also available for use as a blocking control in assays to test for specificity of this GLUD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))
- Alternative Name
- GLUD2 (GLUD2 Products)
- Synonyms
- GDH2 antibody, GLUDP1 antibody, GLUTAMATE DEHYDROGENASE 2 antibody, T2I1.150 antibody, T2I1_150 antibody, glutamate dehydrogenase 2 antibody, glutamate dehydrogenase 2 antibody, glutamate dehydrogenase antibody, GLUD2 antibody, GDH2 antibody, NP_RS03950 antibody
- Background
- Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-