CCBE1 antibody (Middle Region)
-
- Target See all CCBE1 Antibodies
- CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCBE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CCBE1 antibody was raised against the middle region of CCBE1
- Purification
- Affinity purified
- Immunogen
- CCBE1 antibody was raised using the middle region of CCBE1 corresponding to a region with amino acids PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD
- Top Product
- Discover our top product CCBE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCBE1 Blocking Peptide, catalog no. 33R-7221, is also available for use as a blocking control in assays to test for specificity of this CCBE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCBE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))
- Alternative Name
- CCBE1 (CCBE1 Products)
- Synonyms
- 4933426F18Rik antibody, 9430093N24Rik antibody, mKIAA1983 antibody, RGD1307670 antibody, fof antibody, collagen and calcium binding EGF domains 1 antibody, CCBE1 antibody, Ccbe1 antibody, ccbe1 antibody
- Background
- This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans.
- Molecular Weight
- 44 kDa (MW of target protein)
-