MSRA antibody (Middle Region)
-
- Target See all MSRA Antibodies
- MSRA (Methionine Sulfoxide Reductase A (MSRA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MSRA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MSRA antibody was raised against the middle region of MSRA
- Purification
- Affinity purified
- Immunogen
- MSRA antibody was raised using the middle region of MSRA corresponding to a region with amino acids YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS
- Top Product
- Discover our top product MSRA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MSRA Blocking Peptide, catalog no. 33R-10213, is also available for use as a blocking control in assays to test for specificity of this MSRA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSRA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MSRA (Methionine Sulfoxide Reductase A (MSRA))
- Alternative Name
- MSRA (MSRA Products)
- Synonyms
- 2310045J23Rik antibody, 6530413P12Rik antibody, MSR-A antibody, PMSR antibody, methionine sulfoxide reductase A antibody, Msra antibody, MSRA antibody
- Background
- This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 26 kDa (MW of target protein)
-