PRSS22 antibody (N-Term)
-
- Target See all PRSS22 Antibodies
- PRSS22 (Protease, serine, 22 (PRSS22))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRSS22 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRSS22 antibody was raised against the N terminal of PRSS22
- Purification
- Affinity purified
- Immunogen
- PRSS22 antibody was raised using the N terminal of PRSS22 corresponding to a region with amino acids IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW
- Top Product
- Discover our top product PRSS22 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRSS22 Blocking Peptide, catalog no. 33R-4104, is also available for use as a blocking control in assays to test for specificity of this PRSS22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRSS22 (Protease, serine, 22 (PRSS22))
- Alternative Name
- PRSS22 (PRSS22 Products)
- Background
- This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.
- Molecular Weight
- 34 kDa (MW of target protein)
-