CAMK1D antibody (Middle Region)
-
- Target See all CAMK1D Antibodies
- CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CAMK1D antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CAMK1 D antibody was raised against the middle region of CAMK1
- Purification
- Affinity purified
- Immunogen
- CAMK1 D antibody was raised using the middle region of CAMK1 corresponding to a region with amino acids KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS
- Top Product
- Discover our top product CAMK1D Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CAMK1D Blocking Peptide, catalog no. 33R-4567, is also available for use as a blocking control in assays to test for specificity of this CAMK1D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMK0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))
- Alternative Name
- CAMK1D (CAMK1D Products)
- Synonyms
- CKLiK antibody, CaM-K1 antibody, CaMKID antibody, A630059D12Rik antibody, CaMKIdelta antibody, E030025C11Rik antibody, CAMK1D antibody, camk1d antibody, zgc:158713 antibody, RGD1560691 antibody, zgc:172284 antibody, cam-ki antibody, camk1d.L antibody, calcium/calmodulin dependent protein kinase ID antibody, calcium/calmodulin-dependent protein kinase ID antibody, calcium/calmodulin-dependent protein kinase 1Db antibody, calcium/calmodulin-dependent protein kinase 1Da antibody, calcium/calmodulin dependent protein kinase ID S homeolog antibody, CAMK1D antibody, Camk1d antibody, camk1db antibody, LOAG_08089 antibody, camk1da antibody, camk1d.S antibody
- Background
- This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
- Molecular Weight
- 42 kDa (MW of target protein)
-