-
- Target See all APOA2 Antibodies
- APOA2 (Apolipoprotein A-II (APOA2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APOA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ApoA-II antibody was raised against the N terminal of APOA2
- Purification
- Affinity purified
- Immunogen
- ApoA-II antibody was raised using the N terminal of APOA2 corresponding to a region with amino acids MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
- Top Product
- Discover our top product APOA2 Primary Antibody
-
anti-Apolipoprotein A-II (APOA2) (AA 1-100) antibody
APOA2 Reactivity: Human WB, ELISA, IHC (p), IF Host: Mouse Monoclonal 1H6 unconjugated
anti-Apolipoprotein A-II (APOA2) (AA 24-100) antibodyAPOA2 Reactivity: Human WB, ELISA, IHC (p), ICC, IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Apolipoprotein A-II (APOA2) (AA 24-100) antibodyAPOA2 Reactivity: Human, Rat ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Apolipoprotein A-II (APOA2) antibodyAPOA2 Reactivity: Human WB, ELISA, IHC, FACS Host: Rabbit Monoclonal 6H2 unconjugated Recombinant Antibody
anti-Apolipoprotein A-II (APOA2) (AA 28-56) antibodyAPOA2 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB15149 unconjugated
anti-Apolipoprotein A-II (APOA2) (AA 1-100) antibodyAPOA2 Reactivity: Human WB, IF Host: Rabbit Polyclonal unconjugated
anti-Apolipoprotein A-II (APOA2) (AA 24-102) antibodyAPOA2 Reactivity: Rat WB, IHC, ICC Host: Rabbit Polyclonal unconjugated
anti-Apolipoprotein A-II (APOA2) (AA 1-101) antibodyAPOA2 Reactivity: Human WB, IHC (p), EIA Host: Mouse Monoclonal 1H6 unconjugated
anti-Apolipoprotein A-II (APOA2) (AA 23-56) antibodyAPOA2 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Apolipoprotein A-II (APOA2) (Internal Region) antibodyAPOA2 Reactivity: Human, Rat, Mouse WB, ELISA, ICC, IF Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ApoA-II Blocking Peptide, catalog no. 33R-6151, is also available for use as a blocking control in assays to test for specificity of this ApoA-II antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOA2 (Apolipoprotein A-II (APOA2))
- Alternative Name
- ApoA-II (APOA2 Products)
- Synonyms
- Apo-AII antibody, ApoA-II antibody, apoAII antibody, Alp-2 antibody, ApoAII antibody, Apoa-2 antibody, Hdl-1 antibody, APOAII antibody, apoa2 antibody, apoA-II antibody, cb1032 antibody, wu:fb57h11 antibody, zgc:193613 antibody, apolipoprotein A2 antibody, apolipoprotein A-II antibody, APOA2 antibody, Apoa2 antibody, apoa2 antibody
- Background
- This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
- Molecular Weight
- 9 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha, Production of Molecular Mediator of Immune Response, Negative Regulation of Transporter Activity, Lipid Metabolism
-
You are here:
