GDAP2 antibody (N-Term)

Catalog No. ABIN632550

Product Details anti-GDAP2 Antibody

Target: GDAP2 (Ganglioside-Induced Differentiation-Associated-Protein 2 (GDAP2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GDAP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GDAP2 antibody was raised against the N terminal of GDAP2

Purification: Affinity purified

Immunogen: GDAP2 antibody was raised using the N terminal of GDAP2 corresponding to a region with amino acids CRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLA

Application Details

Application Notes: WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GDAP2 Blocking Peptide, catalog no. 33R-1801, is also available for use as a blocking control in assays to test for specificity of this GDAP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GDAP2

Target: GDAP2 (Ganglioside-Induced Differentiation-Associated-Protein 2 (GDAP2))

Alternative Name: GDAP2 (GDAP2 Products)

Synonyms: MACROD3 antibody, dJ776P7.1 antibody, C77050 antibody, D3Ertd801e antibody, ganglioside induced differentiation associated protein 2 antibody, ganglioside-induced differentiation-associated-protein 2 antibody, GDAP2 antibody, Gdap2 antibody

Background: The function of GDAP protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 56 kDa (MW of target protein)