GAS8 antibody (N-Term)
-
- Target See all GAS8 Antibodies
- GAS8 (Growth Arrest-Specific 8 (GAS8))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GAS8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GAS8 antibody was raised against the N terminal of GAS8
- Purification
- Affinity purified
- Immunogen
- GAS8 antibody was raised using the N terminal of GAS8 corresponding to a region with amino acids VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM
- Top Product
- Discover our top product GAS8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GAS8 Blocking Peptide, catalog no. 33R-9820, is also available for use as a blocking control in assays to test for specificity of this GAS8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAS8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GAS8 (Growth Arrest-Specific 8 (GAS8))
- Alternative Name
- GAS8 (GAS8 Products)
- Background
- This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.
- Molecular Weight
- 56 kDa (MW of target protein)
-