GM2A antibody (N-Term)
-
- Target See all GM2A Antibodies
- GM2A (GM2 Ganglioside Activator (GM2A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GM2A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GM2 A antibody was raised against the N terminal of GM2
- Purification
- Affinity purified
- Immunogen
- GM2 A antibody was raised using the N terminal of GM2 corresponding to a region with amino acids SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL
- Top Product
- Discover our top product GM2A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GM2A Blocking Peptide, catalog no. 33R-8939, is also available for use as a blocking control in assays to test for specificity of this GM2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GM2A (GM2 Ganglioside Activator (GM2A))
- Alternative Name
- GM2A (GM2A Products)
- Background
- This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.
- Molecular Weight
- 18 kDa (MW of target protein)
-