GM2A antibody (N-Term)

Catalog No. ABIN632538

Product Details anti-GM2A Antibody

Target: GM2A (GM2 Ganglioside Activator (GM2A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GM2A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GM2 A antibody was raised against the N terminal of GM2

Purification: Affinity purified

Immunogen: GM2 A antibody was raised using the N terminal of GM2 corresponding to a region with amino acids SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GM2A Blocking Peptide, catalog no. 33R-8939, is also available for use as a blocking control in assays to test for specificity of this GM2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GM2A

Target: GM2A (GM2 Ganglioside Activator (GM2A))

Alternative Name: GM2A (GM2A Products)

Synonyms: GM2A antibody, fb96e04 antibody, fb96e10 antibody, wu:fb96e04 antibody, wu:fb96e10 antibody, zgc:110188 antibody, MGC84154 antibody, GM2-AP antibody, SAP-3 antibody, AA408702 antibody, AW215435 antibody, GM2 ganglioside activator antibody, GM2 ganglioside activator L homeolog antibody, GM2 ganglioside activator protein antibody, Gm2a antibody, GM2A antibody, gm2a antibody, gm2a.L antibody

Background: This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.

Molecular Weight: 18 kDa (MW of target protein)