KCTD16 antibody (N-Term)

Catalog No. ABIN632535

Product Details anti-KCTD16 Antibody

Target: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCTD16 antibody was raised against the N terminal of KCTD16

Purification: Affinity purified

Immunogen: KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD16 Blocking Peptide, catalog no. 33R-4621, is also available for use as a blocking control in assays to test for specificity of this KCTD16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD16

Target: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Alternative Name: KCTD16 (KCTD16 Products)

Synonyms: RGD1559856 antibody, 4930434H12Rik antibody, Gm1267 antibody, lrl1 antibody, lrl3 antibody, potassium channel tetramerization domain containing 16 antibody, potassium channel tetramerisation domain containing 16 antibody, potassium channel tetramerization domain containing 16a antibody, potassium channel tetramerization domain containing 16b antibody, Kctd16 antibody, KCTD16 antibody, kctd16 antibody, kctd16a antibody, kctd16b antibody

Background: KCTD16 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling