KCTD16 antibody (N-Term)

Catalog No. ABIN632535

Product Details anti-KCTD16 Antibody

Target: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCTD16 antibody was raised against the N terminal of KCTD16

Purification: Affinity purified

Immunogen: KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD16 Blocking Peptide, catalog no. 33R-4621, is also available for use as a blocking control in assays to test for specificity of this KCTD16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD16

Target: KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))

Alternative Name: KCTD16 (KCTD16 Products)

Background: KCTD16 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling