Retinoic Acid Induced 12 (RAI12) (C-Term) antibody
-
- Target See all Retinoic Acid Induced 12 (RAI12) Antibodies
- Retinoic Acid Induced 12 (RAI12)
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C17 ORF81 antibody was raised against the C terminal Of C17 rf81
- Purification
- Affinity purified
- Immunogen
- C17 ORF81 antibody was raised using the C terminal Of C17 rf81 corresponding to a region with amino acids FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE
- Top Product
- Discover our top product RAI12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C17ORF81 Blocking Peptide, catalog no. 33R-3064, is also available for use as a blocking control in assays to test for specificity of this C17ORF81 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF81 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoic Acid Induced 12 (RAI12)
- Alternative Name
- C17ORF81 (RAI12 Products)
- Background
- C17orf81 belongs to the ELP5 family. C17orf81 may be involved in TP53-mediated transcriptional regulation.
- Molecular Weight
- 31 kDa (MW of target protein)
-