CLPB antibody
-
- Target See all CLPB Antibodies
- CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLPB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKH
- Top Product
- Discover our top product CLPB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLPB Blocking Peptide, catalog no. 33R-2555, is also available for use as a blocking control in assays to test for specificity of this CLPB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLPB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))
- Alternative Name
- CLPB (CLPB Products)
- Synonyms
- HSP78 antibody, SKD3 antibody, AL118244 antibody, Skd3 antibody, ClpB homolog, mitochondrial AAA ATPase chaperonin antibody, ClpB caseinolytic peptidase B antibody, CLPB antibody, Clpb antibody
- Background
- CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.
- Molecular Weight
- 78 kDa (MW of target protein)
-