C2orf42 antibody (C-Term)
-
- Target See all C2orf42 products
- C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))
-
Binding Specificity
- C-Term
-
Reactivity
- Rat, Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C2orf42 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C2 ORF42 antibody was raised against the C terminal Of C2 rf42
- Purification
- Affinity purified
- Immunogen
- C2 ORF42 antibody was raised using the C terminal Of C2 rf42 corresponding to a region with amino acids ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C2ORF42 Blocking Peptide, catalog no. 33R-4188, is also available for use as a blocking control in assays to test for specificity of this C2ORF42 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))
- Alternative Name
- C2ORF42 (C2orf42 Products)
- Background
- The function of C2orf42 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 63 kDa (MW of target protein)
-