C2orf42 antibody (N-Term)

Catalog No. ABIN632521

Product Details anti-C2orf42 Antibody

Target: C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C2orf42 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C2 ORF42 antibody was raised against the N terminal Of C2 rf42

Purification: Affinity purified

Immunogen: C2 ORF42 antibody was raised using the N terminal Of C2 rf42 corresponding to a region with amino acids EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C2ORF42 Blocking Peptide, catalog no. 33R-2639, is also available for use as a blocking control in assays to test for specificity of this C2ORF42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C2orf42

Target: C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))

Alternative Name: C2ORF42 (C2orf42 Products)

Synonyms: C2orf42 antibody, chromosome 22 open reading frame, human C2orf42 antibody, chromosome 2 open reading frame 42 L homeolog antibody, chromosome 2 open reading frame 42 antibody, C22H2ORF42 antibody, c2orf42.L antibody, c2orf42 antibody, C2orf42 antibody

Background: The function of C2orf42 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 63 kDa (MW of target protein)