PPP4R2 antibody (C-Term)

Catalog No. ABIN632513

Product Details anti-PPP4R2 Antibody

Target: PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP4R2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PPP4 R2 antibody was raised against the C terminal of PPP4 2

Purification: Affinity purified

Immunogen: PPP4 R2 antibody was raised using the C terminal of PPP4 2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP4R2 Blocking Peptide, catalog no. 33R-2177, is also available for use as a blocking control in assays to test for specificity of this PPP4R2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP4R2

Target: PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))

Alternative Name: PPP4R2 (PPP4R2 Products)

Synonyms: PP4R2 antibody, BE691708 antibody, C230060M08Rik antibody, ppp4r2 antibody, fe11b04 antibody, wu:fe11b04 antibody, ppp4r2-B antibody, wu:fa17h08 antibody, wu:fc23g05 antibody, protein phosphatase 4 regulatory subunit 2 antibody, protein phosphatase 4, regulatory subunit 2 antibody, protein phosphatase 4, regulatory subunit 2a antibody, protein phosphatase 4 regulatory subunit 2 S homeolog antibody, protein phosphatase 4 regulatory subunit 2 L homeolog antibody, protein phosphatase 4, regulatory subunit 2b antibody, PPP4R2 antibody, Ppp4r2 antibody, ppp4r2a antibody, ppp4r2.S antibody, ppp4r2 antibody, ppp4r2.L antibody, ppp4r2b antibody

Background: PPP4R2 is the regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). It may regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN complex leads to enhance the temporal localization of snRNPs, suggesting a role of PPP4C in maturation of spliceosomal snRNPs. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.

Molecular Weight: 47 kDa (MW of target protein)