PPP4R2 antibody (C-Term)
-
- Target See all PPP4R2 Antibodies
- PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP4R2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PPP4 R2 antibody was raised against the C terminal of PPP4 2
- Purification
- Affinity purified
- Immunogen
- PPP4 R2 antibody was raised using the C terminal of PPP4 2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE
- Top Product
- Discover our top product PPP4R2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP4R2 Blocking Peptide, catalog no. 33R-2177, is also available for use as a blocking control in assays to test for specificity of this PPP4R2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))
- Alternative Name
- PPP4R2 (PPP4R2 Products)
- Background
- PPP4R2 is the regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). It may regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN complex leads to enhance the temporal localization of snRNPs, suggesting a role of PPP4C in maturation of spliceosomal snRNPs. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.
- Molecular Weight
- 47 kDa (MW of target protein)
-