LGALS14 antibody (N-Term)

Catalog No. ABIN632507

Product Details anti-LGALS14 Antibody

Target: LGALS14 (Lectin, Galactoside-Binding, Soluble, 14 (LGALS14))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LGALS14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LGALS14 antibody was raised against the N terminal of LGALS14

Purification: Affinity purified

Immunogen: LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LGALS14 Blocking Peptide, catalog no. 33R-6502, is also available for use as a blocking control in assays to test for specificity of this LGALS14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LGALS14

Target: LGALS14 (Lectin, Galactoside-Binding, Soluble, 14 (LGALS14))

Alternative Name: LGALS14 (LGALS14 Products)

Synonyms: CLC2 antibody, PPL13 antibody, galectin 14 antibody, lectin, galactoside-binding, soluble, 14 antibody, galectin-14 antibody, LGALS14 antibody, LOC443162 antibody

Background: This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside.

Molecular Weight: 16 kDa (MW of target protein)