MYH1 antibody (N-Term)

Catalog No. ABIN632502

Product Details anti-MYH1 Antibody

Target: MYH1 (Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYH1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MYH1 antibody was raised against the N terminal of MYH1

Purification: Affinity purified

Immunogen: MYH1 antibody was raised using the N terminal of MYH1 corresponding to a region with amino acids KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYH1 Blocking Peptide, catalog no. 33R-4695, is also available for use as a blocking control in assays to test for specificity of this MYH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYH1

Target: MYH1 (Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1))

Alternative Name: MYH1 (MYH1 Products)

Synonyms: MYH1 antibody, MYH6 antibody, adult antibody, myosin antibody, A530084A17Rik antibody, IId antibody, IId/x antibody, MHC-2X/D antibody, MHC2X/D antibody, MYHC-IIX antibody, MdMs antibody, MyHC-IId/x antibody, MyHC-IIx/d antibody, Myhs-f antibody, Myhs-f2 antibody, Myhsf2 antibody, MYHC antibody, MYHSA1 antibody, MYHa antibody, MyHC-2X/D antibody, MyHC-2x antibody, MYHC-2X antibody, MYHC-2d antibody, myosin, heavy chain 1E, skeletal muscle antibody, myosin, heavy polypeptide 1, skeletal muscle, adult antibody, myosin heavy chain 1 antibody, myosin, heavy chain 1, skeletal muscle, adult antibody, myosin-8 antibody, myosin-1 antibody, myosin type I antibody, MYH1E antibody, Myh1 antibody, MYH1 antibody, LOC100303760 antibody, LOC100726730 antibody, myo1 antibody

Background: Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP.

Molecular Weight: 223 kDa (MW of target protein)