PSG9 antibody (N-Term)

Catalog No. ABIN632496

Product Details anti-PSG9 Antibody

Target: PSG9 (Pregnancy Specific beta-1-Glycoprotein 9 (PSG9))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSG9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PSG9 antibody was raised against the N terminal of PSG9

Purification: Affinity purified

Immunogen: PSG9 antibody was raised using the N terminal of PSG9 corresponding to a region with amino acids YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSG9 Blocking Peptide, catalog no. 33R-10245, is also available for use as a blocking control in assays to test for specificity of this PSG9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSG9

Target: PSG9 (Pregnancy Specific beta-1-Glycoprotein 9 (PSG9))

Alternative Name: PSG9 (PSG9 Products)

Synonyms: PS34 antibody, PSG11 antibody, PSGII antibody, PSBG-9 antibody, PSBG-11 antibody, pregnancy specific beta-1-glycoprotein 9 antibody, PSG9 antibody

Background: The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily.

Molecular Weight: 54 kDa (MW of target protein)