MAGEA10 antibody (Middle Region)

Catalog No. ABIN632494

Product Details anti-MAGEA10 Antibody

Target: MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEA10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAGEA10 antibody was raised against the middle region of MAGEA10

Purification: Affinity purified

Immunogen: MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEA10 Blocking Peptide, catalog no. 33R-6797, is also available for use as a blocking control in assays to test for specificity of this MAGEA10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEA10

Target: MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))

Alternative Name: MAGEA10 (MAGEA10 Products)

Synonyms: MAGEA10 antibody, CT1.10 antibody, MAGE10 antibody, RGD1563693 antibody, MAGEA11 antibody, MAGE family member A10 antibody, melanoma-associated antigen 10 antibody, melanoma antigen family A, 10 antibody, putative MAGE domain-containing protein MAGEA13P antibody, MAGEA10 antibody, LOC509805 antibody, Magea10 antibody, LOC492173 antibody

Background: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other.

Molecular Weight: 41 kDa (MW of target protein)