DMBT1 antibody (N-Term)

Catalog No. ABIN632489

Product Details anti-DMBT1 Antibody

Target: DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DMBT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DMBT1 antibody was raised against the N terminal of DMBT1

Purification: Affinity purified

Immunogen: DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DMBT1 Blocking Peptide, catalog no. 33R-8945, is also available for use as a blocking control in assays to test for specificity of this DMBT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DMBT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DMBT1

Target: DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))

Alternative Name: DMBT1 (DMBT1 Products)

Synonyms: GP340 antibody, muclin antibody, CRP antibody, CRP-[a] antibody, CRP-[b] antibody, Crpd antibody, DBMT1 antibody, gp300 antibody, p80 antibody, DMBT1 antibody, gp340 antibody, deleted in malignant brain tumors 1 antibody, deleted in malignant brain tumors 1 protein antibody, gp340 antibody, deleted in malignant brain tumors 1 S homeolog antibody, DMBT1 antibody, Dmbt1 antibody, LOC100064515 antibody, dmbt1 antibody, ST201phi2-1p340 antibody, dmbt1.S antibody

Background: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.

Molecular Weight: 258 kDa (MW of target protein)

Pathways: Activation of Innate immune Response