DMBT1 antibody (N-Term)
-
- Target See all DMBT1 Antibodies
- DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DMBT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DMBT1 antibody was raised against the N terminal of DMBT1
- Purification
- Affinity purified
- Immunogen
- DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
- Top Product
- Discover our top product DMBT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DMBT1 Blocking Peptide, catalog no. 33R-8945, is also available for use as a blocking control in assays to test for specificity of this DMBT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DMBT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))
- Alternative Name
- DMBT1 (DMBT1 Products)
- Background
- Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.
- Molecular Weight
- 258 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response
-