TBC1D16 antibody (N-Term)

Catalog No. ABIN632485

Product Details anti-TBC1D16 Antibody

Target: TBC1D16 (TBC1 Domain Family, Member 16 (TBC1D16))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBC1D16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TBC1 D16 antibody was raised against the N terminal of TBC1 16

Purification: Affinity purified

Immunogen: TBC1 D16 antibody was raised using the N terminal of TBC1 16 corresponding to a region with amino acids EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D16 Blocking Peptide, catalog no. 33R-2588, is also available for use as a blocking control in assays to test for specificity of this TBC1D16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBC1D16

Target: TBC1D16 (TBC1 Domain Family, Member 16 (TBC1D16))

Alternative Name: TBC1D16 (TBC1D16 Products)

Synonyms: B930087K01 antibody, BC026530 antibody, Tcd1d16 antibody, TBC1 domain family member 16 antibody, TBC1 domain family, member 16 antibody, TBC1D16 antibody, Tbc1d16 antibody

Background: TBC1D16 may act as a GTPase-activating protein for Rab family proteins.

Molecular Weight: 86 kDa (MW of target protein)