AHNAK2 antibody (Middle Region)

Catalog No. ABIN632478

Product Details anti-AHNAK2 Antibody

Target: AHNAK2 (AHNAK Nucleoprotein 2 (AHNAK2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AHNAK2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AHNAK2 antibody was raised against the middle region of AHNAK2

Purification: Affinity purified

Immunogen: AHNAK2 antibody was raised using the middle region of AHNAK2 corresponding to a region with amino acids AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AHNAK2 Blocking Peptide, catalog no. 33R-1056, is also available for use as a blocking control in assays to test for specificity of this AHNAK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHNAK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AHNAK2

Target: AHNAK2 (AHNAK Nucleoprotein 2 (AHNAK2))

Alternative Name: AHNAK2 (AHNAK2 Products)

Synonyms: C14orf78 antibody, AI450948 antibody, Gm1185 antibody, Gm72 antibody, RGD1309696 antibody, AHNAK nucleoprotein 2 antibody, AHNAK2 antibody, Ahnak2 antibody

Background: The specific function of AHNAK2 is not yet known.

Molecular Weight: 85 kDa (MW of target protein)