ISPD antibody (N-Term)

Catalog No. ABIN632476

Product Details anti-ISPD Antibody

Target: ISPD (Isoprenoid Synthase Domain Containing (ISPD))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ISPD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HCG_1745121 antibody was raised against the N terminal Of Hcg_1745121

Purification: Affinity purified

Immunogen: HCG_1745121 antibody was raised using the N terminal Of Hcg_1745121 corresponding to a region with amino acids MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HCG_1745121 Blocking Peptide, catalog no. 33R-6558, is also available for use as a blocking control in assays to test for specificity of this HCG_1745121 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HCG_1745121 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ISPD

Target: ISPD (Isoprenoid Synthase Domain Containing (ISPD))

Alternative Name: HCG_1745121 (ISPD Products)

Synonyms: MDDGA7 antibody, Nip antibody, 4930579E17Rik antibody, AV040780 antibody, sb:eu371 antibody, zgc:154151 antibody, isoprenoid synthase domain containing antibody, ISPD antibody, ispd antibody, Ispd antibody

Background: The specific function of hCG_1745121 is not yet known.

Molecular Weight: 44 kDa (MW of target protein)