PMM1 antibody (N-Term)

Catalog No. ABIN632467

Product Details anti-PMM1 Antibody

Target: PMM1 (Phosphomannomutase 1 (PMM1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PMM1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PMM1 antibody was raised against the N terminal of PMM1

Purification: Affinity purified

Immunogen: PMM1 antibody was raised using the N terminal of PMM1 corresponding to a region with amino acids MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PMM1 Blocking Peptide, catalog no. 33R-5802, is also available for use as a blocking control in assays to test for specificity of this PMM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PMM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PMM1

Target: PMM1 (Phosphomannomutase 1 (PMM1))

Alternative Name: PMM1 (PMM1 Products)

Synonyms: Sec53 antibody, C77612 antibody, phosphomannomutase 1 antibody, phosphomannomutase 1 L homeolog antibody, PMM1 antibody, pmm1 antibody, Pmm1 antibody, pmm1.L antibody

Background: Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

Molecular Weight: 30 kDa (MW of target protein)