MAGEB3 antibody (N-Term)
-
- Target See all MAGEB3 Antibodies
- MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGEB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAGEB3 antibody was raised against the N terminal of MAGEB3
- Purification
- Affinity purified
- Immunogen
- MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI
- Top Product
- Discover our top product MAGEB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAGEB3 Blocking Peptide, catalog no. 33R-6303, is also available for use as a blocking control in assays to test for specificity of this MAGEB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))
- Alternative Name
- MAGEB3 (MAGEB3 Products)
- Synonyms
- CT3.5 antibody, Smage3 antibody, Mage-b3 antibody, Mage-ps1 antibody, Mage-rs3 antibody, RGD1562343 antibody, MAGEB3 antibody, MAGE family member B3 antibody, melanoma antigen, family B, 3 antibody, melanoma-associated antigen B3 antibody, MAGE family member B5 antibody, MAGEB3 antibody, Mageb3 antibody, LOC509870 antibody, MAGEB5 antibody
- Background
- This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognised on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos
- Molecular Weight
- 39 kDa (MW of target protein)
-