C9orf25 antibody (Middle Region)

Catalog No. ABIN632464

Product Details anti-C9orf25 Antibody

Target: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C9orf25 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C9 ORF25 antibody was raised against the middle region of C9 rf25

Purification: Affinity purified

Immunogen: C9 ORF25 antibody was raised using the middle region of C9 rf25 corresponding to a region with amino acids SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF25 Blocking Peptide, catalog no. 33R-8849, is also available for use as a blocking control in assays to test for specificity of this C9ORF25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C9orf25

Target: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Alternative Name: C9ORF25 (C9orf25 Products)

Synonyms: C9orf25 antibody, bA573M23.5 antibody, C15H9orf25 antibody, 2310028H24Rik antibody, fam219a antibody, zgc:101028 antibody, family with sequence similarity 219 member A antibody, family with sequence similarity 219, member A antibody, family with sequence similarity 219, member Aa antibody, FAM219A antibody, Fam219a antibody, fam219aa antibody

Background: The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus.

Molecular Weight: 18 kDa (MW of target protein)