GBX1 antibody (Middle Region)

Catalog No. ABIN632458

Product Details anti-GBX1 Antibody

Target: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GBX1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GBX1 antibody was raised against the middle region of Gbx-1

Purification: Affinity purified

Immunogen: GBX1 antibody was raised using the middle region of Gbx-1 corresponding to a region with amino acids AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GBX1 Blocking Peptide, catalog no. 33R-1314, is also available for use as a blocking control in assays to test for specificity of this GBX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBX-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GBX1

Target: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Alternative Name: GBX1 (GBX1 Products)

Synonyms: Huh-17 antibody, Gbx-1 antibody, CHOX-7 antibody, GBX-1 antibody, cb619 antibody, fj77a06 antibody, wu:fj77a06 antibody, gastrulation brain homeobox 1 antibody, GBX1 antibody, Gbx1 antibody, gbx1 antibody

Background: GBX-1 contains 1 homeobox DNA-binding domain. The exact functions of GBX-1 remain unknown.

Molecular Weight: 40 kDa (MW of target protein)