GBX1 antibody (Middle Region)
-
- Target See all GBX1 products
- GBX1 (Gastrulation Brain Homeobox 1 (GBX1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Human, Rat, Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GBX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GBX1 antibody was raised against the middle region of Gbx-1
- Purification
- Affinity purified
- Immunogen
- GBX1 antibody was raised using the middle region of Gbx-1 corresponding to a region with amino acids AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GBX1 Blocking Peptide, catalog no. 33R-1314, is also available for use as a blocking control in assays to test for specificity of this GBX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBX-1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GBX1 (Gastrulation Brain Homeobox 1 (GBX1))
- Alternative Name
- GBX1 (GBX1 Products)
- Synonyms
- Huh-17 antibody, Gbx-1 antibody, CHOX-7 antibody, GBX-1 antibody, cb619 antibody, fj77a06 antibody, wu:fj77a06 antibody, gastrulation brain homeobox 1 antibody, GBX1 antibody, Gbx1 antibody, gbx1 antibody
- Background
- GBX-1 contains 1 homeobox DNA-binding domain. The exact functions of GBX-1 remain unknown.
- Molecular Weight
- 40 kDa (MW of target protein)
-