BEND7 antibody (Middle Region)
-
- Target See all BEND7 products
- BEND7 (BEN Domain Containing 7 (BEND7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BEND7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BEND7 antibody was raised against the middle region of BEND7
- Purification
- Affinity purified
- Immunogen
- BEND7 antibody was raised using the middle region of BEND7 corresponding to a region with amino acids LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BEND7 Blocking Peptide, catalog no. 33R-4971, is also available for use as a blocking control in assays to test for specificity of this BEND7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BEND7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BEND7 (BEN Domain Containing 7 (BEND7))
- Alternative Name
- BEND7 (BEND7 Products)
- Synonyms
- C10orf30 antibody, 1110017O21Rik antibody, E130319B15Rik antibody, RGD1305898 antibody, BEN domain containing 7 antibody, si:ch211-220f12.4 antibody, BEND7 antibody, si:ch211-220f12.4 antibody, Bend7 antibody
- Background
- The function of BEND protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 51 kDa (MW of target protein)
-