EIF5A2 antibody (N-Term)
-
- Target See all EIF5A2 Antibodies
- EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF5A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF5 A2 antibody was raised against the N terminal of EIF5 2
- Purification
- Affinity purified
- Immunogen
- EIF5 A2 antibody was raised using the N terminal of EIF5 2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK
- Top Product
- Discover our top product EIF5A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF5A2 Blocking Peptide, catalog no. 33R-5619, is also available for use as a blocking control in assays to test for specificity of this EIF5A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))
- Alternative Name
- EIF5A2 (EIF5A2 Products)
- Background
- EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.
- Molecular Weight
- 17 kDa (MW of target protein)
-