FAM83E antibody (Middle Region)

Catalog No. ABIN632448

Product Details anti-FAM83E Antibody

Target: FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM83E antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM83 E antibody was raised against the middle region of FAM83

Purification: Affinity purified

Immunogen: FAM83 E antibody was raised using the middle region of FAM83 corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM83E Blocking Peptide, catalog no. 33R-7823, is also available for use as a blocking control in assays to test for specificity of this FAM83E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM83E

Target: FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))

Alternative Name: FAM83E (FAM83E Products)

Synonyms: 4930403C10Rik antibody, family with sequence similarity 83 member E antibody, family with sequence similarity 83, member E antibody, FAM83E antibody, Fam83e antibody

Background: The function of FAM83 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 52 kDa (MW of target protein)