FAM83E antibody (Middle Region)
-
- Target See all FAM83E products
- FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM83E antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM83 E antibody was raised against the middle region of FAM83
- Purification
- Affinity purified
- Immunogen
- FAM83 E antibody was raised using the middle region of FAM83 corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM83E Blocking Peptide, catalog no. 33R-7823, is also available for use as a blocking control in assays to test for specificity of this FAM83E antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))
- Alternative Name
- FAM83E (FAM83E Products)
- Synonyms
- 4930403C10Rik antibody, family with sequence similarity 83 member E antibody, family with sequence similarity 83, member E antibody, FAM83E antibody, Fam83e antibody
- Background
- The function of FAM83 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 52 kDa (MW of target protein)
-