CMTR2 antibody (Middle Region)

Catalog No. ABIN632447

Product Details anti-CMTR2 Antibody

Target: CMTR2 (Cap Methyltransferase 2 (CMTR2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CMTR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FTSJD1 antibody was raised against the middle region of FTSJD1

Purification: Affinity purified

Immunogen: FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FTSJD1 Blocking Peptide, catalog no. 33R-5216, is also available for use as a blocking control in assays to test for specificity of this FTSJD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CMTR2

Target: CMTR2 (Cap Methyltransferase 2 (CMTR2))

Alternative Name: FTSJD1 (CMTR2 Products)

Background: The function of FTSJ protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 88 kDa (MW of target protein)