BEND7 antibody (N-Term)

Catalog No. ABIN632443

Product Details anti-BEND7 Antibody

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BEND7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C10 orf30 antibody was raised against the N terminal of C10 rf30

Purification: Affinity purified

Immunogen: C10 orf30 antibody was raised using the N terminal of C10 rf30 corresponding to a region with amino acids AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10orf30 Blocking Peptide, catalog no. 33R-1224, is also available for use as a blocking control in assays to test for specificity of this C10orf30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BEND7

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Alternative Name: C10orf30 (BEND7 Products)

Synonyms: C10orf30 antibody, 1110017O21Rik antibody, E130319B15Rik antibody, RGD1305898 antibody, BEN domain containing 7 antibody, si:ch211-220f12.4 antibody, BEND7 antibody, si:ch211-220f12.4 antibody, Bend7 antibody

Background: The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 51 kDa (MW of target protein)