Exophilin 5 antibody (Middle Region)
-
- Target See all Exophilin 5 (EXPH5) Antibodies
- Exophilin 5 (EXPH5)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Exophilin 5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EXPH5 antibody was raised against the middle region of EXPH5
- Purification
- Affinity purified
- Immunogen
- EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL
- Top Product
- Discover our top product EXPH5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EXPH5 Blocking Peptide, catalog no. 33R-7572, is also available for use as a blocking control in assays to test for specificity of this EXPH5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXPH5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Exophilin 5 (EXPH5)
- Alternative Name
- EXPH5 (EXPH5 Products)
- Synonyms
- RGD1560308 antibody, AC079869.22gm5 antibody, B130009M24Rik antibody, E030050P12 antibody, Kiaa0624 antibody, Slac2b antibody, slac2-b antibody, DKFZp469K2410 antibody, SLAC2-B antibody, SLAC2B antibody, exophilin 5 antibody, Exph5 antibody, EXPH5 antibody
- Background
- EXPH5 may act as a Rab effector protein and play a role in vesicle trafficking.
- Molecular Weight
- 222 kDa (MW of target protein)
-