LRP2BP antibody (Middle Region)

Catalog No. ABIN632431

Product Details anti-LRP2BP Antibody

Target: LRP2BP (LRP2 Binding Protein (LRP2BP))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRP2BP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRP2 BP antibody was raised against the middle region of LRP2 P

Purification: Affinity purified

Immunogen: LRP2 BP antibody was raised using the middle region of LRP2 P corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRP2BP Blocking Peptide, catalog no. 33R-8200, is also available for use as a blocking control in assays to test for specificity of this LRP2BP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRP2BP

Target: LRP2BP (LRP2 Binding Protein (LRP2BP))

Alternative Name: LRP2BP (LRP2BP Products)

Synonyms: 1700113N17Rik antibody, 2310006J04Rik antibody, 4930479L12Rik antibody, MegBP antibody, RGD1305896 antibody, LRP2BP antibody, zgc:165631 antibody, LRP2 binding protein antibody, Lrp2 binding protein antibody, LRP2 binding protein S homeolog antibody, LRP2BP antibody, Lrp2bp antibody, lrp2bp antibody, lrp2bp.S antibody

Background: LRP2BP may act as an adapter that regulates LRP2 function.

Molecular Weight: 38 kDa (MW of target protein)