SPATA16 antibody (N-Term)

Catalog No. ABIN632429

Product Details anti-SPATA16 Antibody

Target: SPATA16 (Spermatogenesis Associated 16 (SPATA16))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPATA16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPATA16 antibody was raised against the N terminal of SPATA16

Purification: Affinity purified

Immunogen: SPATA16 antibody was raised using the N terminal of SPATA16 corresponding to a region with amino acids MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPATA16 Blocking Peptide, catalog no. 33R-5820, is also available for use as a blocking control in assays to test for specificity of this SPATA16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPATA16

Target: SPATA16 (Spermatogenesis Associated 16 (SPATA16))

Alternative Name: SPATA16 (SPATA16 Products)

Synonyms: RGD1563726 antibody, NYD-SP12 antibody, SPGF6 antibody, 4921511F01Rik antibody, 4930503K02Rik antibody, Nyd-sp12 antibody, spermatogenesis associated 16 antibody, Spata16 antibody, SPATA16 antibody

Background: SPATA16 is involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion. Defects in SPATA16 are a cause of globozoospermia, also called Round-headed spermatozoa.

Molecular Weight: 63 kDa (MW of target protein)