GLRX5 antibody (Middle Region)

Catalog No. ABIN632427

Product Details anti-GLRX5 Antibody

Target: GLRX5 (Glutaredoxin 5 (GLRX5))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLRX5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLRX5 antibody was raised against the middle region of GLRX5

Purification: Affinity purified

Immunogen: GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLRX5 Blocking Peptide, catalog no. 33R-6648, is also available for use as a blocking control in assays to test for specificity of this GLRX5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLRX5

Target: GLRX5 (Glutaredoxin 5 (GLRX5))

Alternative Name: GLRX5 (GLRX5 Products)

Synonyms: grx5 antibody, C14orf87 antibody, FLB4739 antibody, GRX5 antibody, PR01238 antibody, PRO1238 antibody, RGD1308383 antibody, 2310004O13Rik antibody, 2900070E19Rik antibody, AU020725 antibody, id:ibd5119 antibody, wu:fa09g08 antibody, zgc:73343 antibody, glutaredoxin 5 L homeolog antibody, glutaredoxin 5 antibody, glutaredoxin 5 homolog (S. cerevisiae) antibody, glrx5.L antibody, GLRX5 antibody, Glrx5 antibody, glrx5 antibody

Background: Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis