KLHL7 antibody

Catalog No. ABIN632426

Product Details anti-KLHL7 Antibody

Target: KLHL7 (Kelch-Like 7 (KLHL7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL7 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: KLHL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL7 Blocking Peptide, catalog no. 33R-1597, is also available for use as a blocking control in assays to test for specificity of this KLHL7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL7

Target: KLHL7 (Kelch-Like 7 (KLHL7))

Alternative Name: KLHL7 (KLHL7 Products)

Synonyms: KLHL6 antibody, SBBI26 antibody, 2700038B03Rik antibody, D5Ertd363e antibody, kelch like family member 7 antibody, kelch-like 7 antibody, kelch-like family member 7 antibody, kelch like family member 7 S homeolog antibody, KLHL7 antibody, Klhl7 antibody, klhl7.S antibody

Background: Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.

Molecular Weight: 62 kDa (MW of target protein)