RD3 antibody (N-Term)

Catalog No. ABIN632425

Product Details anti-RD3 Antibody

Target: RD3 (Retinal Degeneration 3 (RD3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RD3 antibody was raised against the N terminal of RD3

Purification: Affinity purified

Immunogen: RD3 antibody was raised using the N terminal of RD3 corresponding to a region with amino acids GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RD3 Blocking Peptide, catalog no. 33R-3503, is also available for use as a blocking control in assays to test for specificity of this RD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RD3

Target: RD3 (Retinal Degeneration 3 (RD3))

Alternative Name: RD3 (RD3 Products)

Synonyms: C1orf36 antibody, LCA12 antibody, 3322402L07Rik antibody, rd-3 antibody, rd3 antibody, retinal degeneration 3 antibody, RD3 antibody, Rd3 antibody

Background: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Molecular Weight: 23 kDa (MW of target protein)