SH3BGRL antibody (Middle Region)
-
- Target See all SH3BGRL Antibodies
- SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SH3BGRL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SH3 BGRL antibody was raised against the middle region of SH3 GRL
- Purification
- Affinity purified
- Immunogen
- SH3 BGRL antibody was raised using the middle region of SH3 GRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
- Top Product
- Discover our top product SH3BGRL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SH3BGRL Blocking Peptide, catalog no. 33R-7300, is also available for use as a blocking control in assays to test for specificity of this SH3BGRL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GRL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))
- Alternative Name
- SH3BGRL (SH3BGRL Products)
- Synonyms
- sh3bgr antibody, SH3BGR antibody, 1190008F14Rik antibody, SH3BGRL antibody, RGD1560520 antibody, SH3 domain binding glutamate-rich protein like L homeolog antibody, SH3 domain binding glutamate rich protein like antibody, SH3-binding domain glutamic acid-rich protein like antibody, SH3 domain binding glutamate-rich protein like antibody, SH3 domain binding glutamic acid-rich protein like antibody, sh3bgrl.L antibody, SH3BGRL antibody, Sh3bgrl antibody, sh3bgrl antibody
- Background
- SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.
- Molecular Weight
- 13 kDa (MW of target protein)
-