SH3BGRL antibody (Middle Region)

Catalog No. ABIN632421

Product Details anti-SH3BGRL Antibody

Target: SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3BGRL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SH3 BGRL antibody was raised against the middle region of SH3 GRL

Purification: Affinity purified

Immunogen: SH3 BGRL antibody was raised using the middle region of SH3 GRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3BGRL Blocking Peptide, catalog no. 33R-7300, is also available for use as a blocking control in assays to test for specificity of this SH3BGRL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GRL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3BGRL

Target: SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))

Alternative Name: SH3BGRL (SH3BGRL Products)

Synonyms: sh3bgr antibody, SH3BGR antibody, 1190008F14Rik antibody, SH3BGRL antibody, RGD1560520 antibody, SH3 domain binding glutamate-rich protein like L homeolog antibody, SH3 domain binding glutamate rich protein like antibody, SH3-binding domain glutamic acid-rich protein like antibody, SH3 domain binding glutamate-rich protein like antibody, SH3 domain binding glutamic acid-rich protein like antibody, sh3bgrl.L antibody, SH3BGRL antibody, Sh3bgrl antibody, sh3bgrl antibody

Background: SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.

Molecular Weight: 13 kDa (MW of target protein)