TPPP3 antibody (N-Term)

Catalog No. ABIN632414

Product Details anti-TPPP3 Antibody

Target: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPPP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TPPP3 antibody was raised against the N terminal of TPPP3

Purification: Affinity purified

Immunogen: TPPP3 antibody was raised using the N terminal of TPPP3 corresponding to a region with amino acids MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPPP3 Blocking Peptide, catalog no. 33R-5611, is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPPP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPPP3

Target: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Alternative Name: TPPP3 (TPPP3 Products)

Synonyms: p20 antibody, p25gamma antibody, 2700055K07Rik antibody, CGI-38 antibody, Ceacam9 antibody, mmCGM8 antibody, RGD1305061 antibody, tubulin polymerization promoting protein family member 3 antibody, tubulin polymerization-promoting protein family member 3 antibody, tubulin polymerization-promoting protein family member 3 L homeolog antibody, TPPP3 antibody, Tppp3 antibody, tppp3.L antibody

Background: TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.

Molecular Weight: 19 kDa (MW of target protein)