OSGEP antibody (N-Term)

Catalog No. ABIN632411

Product Details anti-OSGEP Antibody

Target: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OSGEP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OSGEP antibody was raised against the N terminal of OSGEP

Purification: Affinity purified

Immunogen: OSGEP antibody was raised using the N terminal of OSGEP corresponding to a region with amino acids PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OSGEP Blocking Peptide, catalog no. 33R-7254, is also available for use as a blocking control in assays to test for specificity of this OSGEP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGEP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OSGEP

Target: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Alternative Name: OSGEP (OSGEP Products)

Synonyms: MGC64557 antibody, wu:fj38e02 antibody, zgc:112527 antibody, si:ch211-214j24.11 antibody, Afu6g04510 antibody, Tb07.33N13.430 antibody, GCPL1 antibody, KAE1 antibody, OSGEP1 antibody, PRSMG1 antibody, 1500019L24Rik antibody, GCPL-1 antibody, O-sialoglycoprotein endopeptidase L homeolog antibody, O-sialoglycoprotein endopeptidase antibody, o-sialoglycoprotein endopeptidase antibody, osgep.L antibody, OSGEP antibody, osgep antibody, CNA03390 antibody, AFUA_6G04510 antibody, Tc00.1047053508913.39 antibody, Tc00.1047053506515.20 antibody, Tb927.7.6470 antibody, PVX_111195 antibody, AaeL_AAEL001942 antibody, GL50803_17420 antibody, EDI_342200 antibody, CC1G_03622 antibody, THAPSDRAFT_2332 antibody, TTHERM_00442549 antibody, Osgep antibody, LOC100273984 antibody

Background: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Molecular Weight: 36 kDa (MW of target protein)