VTA1 antibody
-
- Target See all VTA1 Antibodies
- VTA1 (Vps20-Associated 1 Homolog (VTA1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VTA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
- Top Product
- Discover our top product VTA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VTA1 Blocking Peptide, catalog no. 33R-4488, is also available for use as a blocking control in assays to test for specificity of this VTA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VTA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VTA1 (Vps20-Associated 1 Homolog (VTA1))
- Alternative Name
- VTA1 (VTA1 Products)
- Synonyms
- C6orf55 antibody, DRG-1 antibody, DRG1 antibody, LIP5 antibody, My012 antibody, SBP1 antibody, 1110001D18Rik antibody, 1110059P08Rik antibody, AU040813 antibody, C85340 antibody, Lip5 antibody, RGD1305031 antibody, Vps20-associated 1 homolog antibody, vesicle trafficking 1 antibody, vesicle (multivesicular body) trafficking 1 antibody, Vta1 antibody, VTA1 antibody
- Background
- C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.
- Molecular Weight
- 34 kDa (MW of target protein)
-