SH3GL1 antibody (N-Term)

Catalog No. ABIN632409

Product Details anti-SH3GL1 Antibody

Target: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3GL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SH3 GL1 antibody was raised against the N terminal of SH3 L1

Purification: Affinity purified

Immunogen: SH3 GL1 antibody was raised using the N terminal of SH3 L1 corresponding to a region with amino acids LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3GL1 Blocking Peptide, catalog no. 33R-5248, is also available for use as a blocking control in assays to test for specificity of this SH3GL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3GL1

Target: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Alternative Name: SH3GL1 (SH3GL1 Products)

Synonyms: CNSA1 antibody, EEN antibody, SH3D2B antibody, SH3P8 antibody, C77078 antibody, Sh3d2b antibody, cb831 antibody, sh3gl1 antibody, MGC78966 antibody, MGC130739 antibody, sh3gl1b antibody, wu:fd12b05 antibody, wu:fy33c10 antibody, zgc:56637 antibody, SH3 domain containing GRB2 like 1, endophilin A2 antibody, SH3-domain GRB2-like 1 antibody, SH3-domain GRB2-like 1b antibody, SH3-domain GRB2-like 1 L homeolog antibody, SH3-domain GRB2-like 1a antibody, SH3GL1 antibody, Sh3gl1 antibody, sh3gl1b antibody, sh3gl1.L antibody, sh3gl1 antibody, sh3gl1a antibody

Background: SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Molecular Weight: 41 kDa (MW of target protein)