TMED8 antibody (Middle Region)

Catalog No. ABIN632407

Product Details anti-TMED8 Antibody

Target: TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMED8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMED8 antibody was raised against the middle region of TMED8

Purification: Affinity purified

Immunogen: TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMED8 Blocking Peptide, catalog no. 33R-2466, is also available for use as a blocking control in assays to test for specificity of this TMED8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMED8

Target: TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))

Alternative Name: TMED8 (TMED8 Products)

Synonyms: 6430595O10Rik antibody, AI447224 antibody, Gm1184 antibody, Mem1 antibody, FAM15B antibody, zgc:112014 antibody, transmembrane p24 trafficking protein 8 antibody, transmembrane p24 trafficking protein family member 8 antibody, Tmed8 antibody, TMED8 antibody, tmed8 antibody

Background: The function of TMED8 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 36 kDa (MW of target protein)