TMED8 antibody (Middle Region)
-
- Target See all TMED8 products
- TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMED8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMED8 antibody was raised against the middle region of TMED8
- Purification
- Affinity purified
- Immunogen
- TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMED8 Blocking Peptide, catalog no. 33R-2466, is also available for use as a blocking control in assays to test for specificity of this TMED8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))
- Alternative Name
- TMED8 (TMED8 Products)
- Synonyms
- 6430595O10Rik antibody, AI447224 antibody, Gm1184 antibody, Mem1 antibody, FAM15B antibody, zgc:112014 antibody, transmembrane p24 trafficking protein 8 antibody, transmembrane p24 trafficking protein family member 8 antibody, Tmed8 antibody, TMED8 antibody, tmed8 antibody
- Background
- The function of TMED8 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 36 kDa (MW of target protein)
-