ICA1 antibody (C-Term)
-
- Target See all ICA1 Antibodies
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ICA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ICA1 antibody was raised against the C terminal of ICA1
- Purification
- Affinity purified
- Immunogen
- ICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA
- Top Product
- Discover our top product ICA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ICA1 Blocking Peptide, catalog no. 33R-6795, is also available for use as a blocking control in assays to test for specificity of this ICA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
- Alternative Name
- ICA1 (ICA1 Products)
- Synonyms
- ica1 antibody, MGC52730 antibody, ICA1 antibody, DKFZp469G0321 antibody, zgc:92566 antibody, 69kDa antibody, ICA69 antibody, Ica69 antibody, MGC83241 antibody, ICAp69 antibody, islet cell autoantigen 1 L homeolog antibody, islet cell autoantigen 1 antibody, Islet cell autoantigen 1 antibody, islet cell autoantigen 1 S homeolog antibody, ica1.L antibody, ICA1 antibody, ica1 antibody, ica69 antibody, Ica1 antibody, ica1.S antibody
- Background
- ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome.
- Molecular Weight
- 53 kDa (MW of target protein)
-