TTC23L antibody (N-Term)
-
- Target See all TTC23L products
- TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TTC23L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FLJ25439 antibody was raised against the N terminal Of Flj25439
- Purification
- Affinity purified
- Immunogen
- FLJ25439 antibody was raised using the N terminal Of Flj25439 corresponding to a region with amino acids MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FLJ25439 Blocking Peptide, catalog no. 33R-6319, is also available for use as a blocking control in assays to test for specificity of this FLJ25439 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25439 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))
- Abstract
- TTC23L Products
- Background
- The function of FLJ25439 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 41 kDa (MW of target protein)
-