LYSMD1 antibody (N-Term)

Catalog No. ABIN632386

Product Details anti-LYSMD1 Antibody

Target: LYSMD1 (LysM, Putative Peptidoglycan-Binding, Domain Containing 1 (LYSMD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYSMD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYSMD1 antibody was raised against the N terminal of LYSMD1

Purification: Affinity purified

Immunogen: LYSMD1 antibody was raised using the N terminal of LYSMD1 corresponding to a region with amino acids VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYSMD1 Blocking Peptide, catalog no. 33R-9771, is also available for use as a blocking control in assays to test for specificity of this LYSMD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYSMD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYSMD1

Target: LYSMD1 (LysM, Putative Peptidoglycan-Binding, Domain Containing 1 (LYSMD1))

Alternative Name: LYSMD1 (LYSMD1 Products)

Synonyms: zgc:153301 antibody, LYSMD1 antibody, RP11-68I18.5 antibody, 2610022K04Rik antibody, AI415311 antibody, LysM domain containing 1 antibody, LysM, putative peptidoglycan-binding, domain containing 1 antibody, LysM, putative peptidoglycan-binding, domain containing 1 S homeolog antibody, LYSMD1 antibody, lysmd1 antibody, lysmd1.S antibody, Lysmd1 antibody

Background: The function of LYSMD1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 25 kDa (MW of target protein)